Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm6185 Peptide - middle region

Gm6185 Peptide - middle region

Product Specifications

Product Name Alternative

EG620839

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_901143

Preservative

Lyophilized powder

AA Sequence

MYSITKGYVKSQEDAKLLIRQISGRESIYRKLYDILEKNKREAIRELGLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS626460 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
CD84 (NM_001184879) Human Over-expression Lysate
LC432917 20 µg

CD84 (NM_001184879) Human Over-expression Lysate

Sign In for Pricing
View Details
ASC 67131
TRC-A101260-500MG 500 mg

ASC 67131

Sign In for Pricing
View Details
Fatty Acid and Lipid Metabolism Antibody Sampler Kit
HAK21048 1 Kit

Fatty Acid and Lipid Metabolism Antibody Sampler Kit

Sign In for Pricing
View Details
Human GPR97 (ADGRG3) activation kit by CRISPRa
GA116669 1 Kit

Human GPR97 (ADGRG3) activation kit by CRISPRa

Sign In for Pricing
View Details
VSIG10 Polyclonal Antibody
E-AB-17553-01 20 µL

VSIG10 Polyclonal Antibody

Sign In for Pricing
View Details