Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm6185 Peptide - middle region

Gm6185 Peptide - middle region

Product Specifications

Product Name Alternative

EG620839

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_901143

Preservative

Lyophilized powder

AA Sequence

MYSITKGYVKSQEDAKLLIRQISGRESIYRKLYDILEKNKREAIRELGLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTC4S Human qPCR Primer Pair (NM_145867)
HP232904 200 Reactions

LTC4S Human qPCR Primer Pair (NM_145867)

Sign In for Pricing
View Details
Moricizine
TRC-M635025-50MG 50 mg

Moricizine

Sign In for Pricing
View Details
ReadiLink™ Cy5 Nick Translation dsDNA Labeling Kit
17408-AAT 10 Reactions

ReadiLink™ Cy5 Nick Translation dsDNA Labeling Kit

Sign In for Pricing
View Details
Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit
E-EL-H6182-01 24 Tests

Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit

Sign In for Pricing
View Details
Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit
E-EL-H6182-02 48 Tests

Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit

Sign In for Pricing
View Details
Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit
E-EL-H6182-03 96 Tests

Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit

Sign In for Pricing
View Details