Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gmppb Peptide - N-terminal region

Gmppb Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI317178, E430010H19

UniProt

Q8BTZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gmppb Rabbit Polyclonal Antibody (orb580557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_808578

Preservative

Lyophilized powder

AA Sequence

KALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr591-set siRNA/shRNA/RNAi Lentivector (Mouse)
33282094 4x 500 ng

Olfr591-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) HYCD Polyclonal Antibody
MBS7153297 Inquire

Rabbit anti-Escherichia coli (strain K12) HYCD Polyclonal Antibody

Sign In for Pricing
View Details
RT1-CE14 Protein Vector (Rat) (pPM-C-His)
PV302773 500 ng

RT1-CE14 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
CD104 (Integrin beta-4, GP150, ITGB4)
C2446-01Q 100 µg

CD104 (Integrin beta-4, GP150, ITGB4)

Sign In for Pricing
View Details
Rabbit Polyclonal LXR beta/NR1H2 Antibody [Janelia Fluor 646]
NBP1-76256JF646 0.1 mL

Rabbit Polyclonal LXR beta/NR1H2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
GRIN2B Recombinant Protein
OPCD03682-200UG 200 µg

GRIN2B Recombinant Protein

Sign In for Pricing
View Details