Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMPR Peptide - C-terminal region

GMPR Peptide - C-terminal region

Product Specifications

Product Name Alternative

GMPR1

UniProt

Q5NUL3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GMPR Rabbit Polyclonal Antibody (orb585370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859529

Preservative

Lyophilized powder

AA Sequence

TAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM86A 3'UTR Lenti-reporter-Luc Vector
20154081 1.0 µg

FAM86A 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PIRC61 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV740697 1.0 µg DNA

PIRC61 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Thymidine Phosphorylase (TYMP) Mouse Monoclonal Antibody [Clone:5B11]
E45M14939 100 µg

Thymidine Phosphorylase (TYMP) Mouse Monoclonal Antibody [Clone:5B11]

Sign In for Pricing
View Details
Human COL5a1 (Collagen Type V Alpha 1) ELISA Kit
MBS8820710-01 48 Well

Human COL5a1 (Collagen Type V Alpha 1) ELISA Kit

Sign In for Pricing
View Details
Human COL5a1 (Collagen Type V Alpha 1) ELISA Kit
MBS8820710-02 96 Well

Human COL5a1 (Collagen Type V Alpha 1) ELISA Kit

Sign In for Pricing
View Details
Human COL5a1 (Collagen Type V Alpha 1) ELISA Kit
MBS8820710-03 5x 96 Well

Human COL5a1 (Collagen Type V Alpha 1) ELISA Kit

Sign In for Pricing
View Details