Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMPR Peptide - C-terminal region

GMPR Peptide - C-terminal region

Product Specifications

Product Name Alternative

GMPR1

UniProt

Q5NUL3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GMPR Rabbit Polyclonal Antibody (orb585370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859529

Preservative

Lyophilized powder

AA Sequence

TAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU6-28 Protein Vector (Human) (pPB-C-His)
PV118766 500 ng

RNU6-28 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Mavs (NM_001206382) Mouse Tagged ORF Clone
MR229300 10 µg

Mavs (NM_001206382) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FITC anti-mouse TCR Vδ6.3
GT05587 100 µg

FITC anti-mouse TCR Vδ6.3

Sign In for Pricing
View Details
GMF-gamma Polyclonal Antibody
MBS8595355-01 0.1 mg

GMF-gamma Polyclonal Antibody

Sign In for Pricing
View Details
GMF-gamma Polyclonal Antibody
MBS8595355-02 0.1 mL (AF405L)

GMF-gamma Polyclonal Antibody

Sign In for Pricing
View Details
GMF-gamma Polyclonal Antibody
MBS8595355-03 0.1 mL (AF405S)

GMF-gamma Polyclonal Antibody

Sign In for Pricing
View Details