Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gnmt Peptide - N-terminal region

Gnmt Peptide - N-terminal region

Product Specifications

UniProt

Q9QXF8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gnmt Rabbit Polyclonal Antibody (orb578866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034451

Preservative

Lyophilized powder

AA Sequence

GVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS504494 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Analytical Balance BBAL-101
BBAL-101 1 Unit

Analytical Balance BBAL-101

Sign In for Pricing
View Details
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF647 conjugate, 0.1mg/mL
BNC472981-100 1x 100 µL

Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Phospho Tyrosine Antibody
KC-6055-01 50 μL

Anti-Phospho Tyrosine Antibody

Sign In for Pricing
View Details
Anti-Phospho Tyrosine Antibody
KC-6055-02 100 µL

Anti-Phospho Tyrosine Antibody

Sign In for Pricing
View Details
Anti-Phospho Tyrosine Antibody
KC-6055-03 1 mL

Anti-Phospho Tyrosine Antibody

Sign In for Pricing
View Details