Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gnmt Peptide - N-terminal region

Gnmt Peptide - N-terminal region

Product Specifications

UniProt

Q9QXF8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gnmt Rabbit Polyclonal Antibody (orb578866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034451

Preservative

Lyophilized powder

AA Sequence

GVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary
CS700536 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Hist1h2ail1 (pThr11) Mouse Monoclonal Antibody [Clone ID: N123/19]
75-223 100 µL

Hist1h2ail1 (pThr11) Mouse Monoclonal Antibody [Clone ID: N123/19]

Sign In for Pricing
View Details
2-Amino-4-chloropyridine
TRC-A603512-25G 25 g

2-Amino-4-chloropyridine

Sign In for Pricing
View Details
Bccip Mouse Gene Knockout Kit (CRISPR)
KN502087 1 Kit

Bccip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FUS (C-term) Rabbit Polyclonal Antibody
AP51735PU-N 400 µL

FUS (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DAPK1 (Ab-308) Antibody
8B0898-AAT 50 µg

DAPK1 (Ab-308) Antibody

Sign In for Pricing
View Details