Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gnmt Peptide - C-terminal region

Gnmt Peptide - C-terminal region

Product Specifications

UniProt

Q9QXF8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gnmt Rabbit Polyclonal Antibody (orb578867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034451

Preservative

Lyophilized powder

AA Sequence

FSKFRLSYYPHCLASFTELVRAAFGGRCQHSVLGDFKPYKPGQAYVPCYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAP1 Antibody
KC-8467-01 50 μL

KAP1 Antibody

Sign In for Pricing
View Details
KAP1 Antibody
KC-8467-02 100 µL

KAP1 Antibody

Sign In for Pricing
View Details
KAP1 Antibody
KC-8467-03 1 mL

KAP1 Antibody

Sign In for Pricing
View Details
1-Bromopropane-d7
TRC-B687138-500MG 500 mg

1-Bromopropane-d7

Sign In for Pricing
View Details
CD13 Antibody (Biotin)
KB-7507-01 50 μL

CD13 Antibody (Biotin)

Sign In for Pricing
View Details
CD13 Antibody (Biotin)
KB-7507-02 100 µL

CD13 Antibody (Biotin)

Sign In for Pricing
View Details