Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gnpda1 Peptide - N-terminal region

Gnpda1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC189374

UniProt

B5DFC6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gnpda1 Rabbit Polyclonal Antibody (orb580356) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128467

Preservative

Lyophilized powder

AA Sequence

QKLIEYYKNGDLSFKYVKTFNMDEYVGLPREHPESYHSFMWNNFFKHIDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS703050 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
MA2 (PNMA2) (NM_007257) Human Recombinant Protein
TP307316M 100 µg

MA2 (PNMA2) (NM_007257) Human Recombinant Protein

Sign In for Pricing
View Details
Protein A Biotin
BAP-01-2 2 mg

Protein A Biotin

Sign In for Pricing
View Details
BRP44 Antibody
8C14780-AAT 50 µg

BRP44 Antibody

Sign In for Pricing
View Details
Isoproturon-d6
TRC-I874504-2.5MG 2.5 mg

Isoproturon-d6

Sign In for Pricing
View Details
MCP1 (CCL2) Mouse Monoclonal Antibody [Clone ID: 1A7B8]
AM06084PU-N 100 µL

MCP1 (CCL2) Mouse Monoclonal Antibody [Clone ID: 1A7B8]

Sign In for Pricing
View Details