Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gnpda1 Peptide - N-terminal region

Gnpda1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC189374

UniProt

B5DFC6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gnpda1 Rabbit Polyclonal Antibody (orb580356) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128467

Preservative

Lyophilized powder

AA Sequence

QKLIEYYKNGDLSFKYVKTFNMDEYVGLPREHPESYHSFMWNNFFKHIDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf94 (NM_001080446) Human Over-expression Lysate
LY421662 100 µg

C11orf94 (NM_001080446) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Metastasis, unknown source
CB501430 1 Block

Frozen Tissue Blocks, Metastasis, unknown source

Sign In for Pricing
View Details
SNP23 Polyclonal Antibody
E-AB-40243-01 25 µL

SNP23 Polyclonal Antibody

Sign In for Pricing
View Details
SNP23 Polyclonal Antibody
E-AB-40243-02 100 µL

SNP23 Polyclonal Antibody

Sign In for Pricing
View Details
Phalloidin, CF®532, 300 U
#00051 1x 300 U

Phalloidin, CF®532, 300 U

Sign In for Pricing
View Details
CO2 Incubator Air Jacketed BCAJ-8405
BCAJ-8405 1 Unit

CO2 Incubator Air Jacketed BCAJ-8405

Sign In for Pricing
View Details