Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNPTAB Peptide - N-terminal region

GNPTAB Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp762B226, GNPTA, ICD, KIAA1208, MGC4170

UniProt

Q3T906

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GNPTAB Rabbit Polyclonal Antibody (orb580879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077288

Preservative

Lyophilized powder

AA Sequence

FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS702190 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
3,3-Diethoxy-1-propanol
TRC-D442995-250MG 250 mg

3,3-Diethoxy-1-propanol

Sign In for Pricing
View Details
LANCL2 (NM_018697) Human Recombinant Protein
TP309751L 1 mg

LANCL2 (NM_018697) Human Recombinant Protein

Sign In for Pricing
View Details
PRPF40B Human Gene Knockout Kit (CRISPR)
KN209144LP 1 Kit

PRPF40B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EP300 Human Gene Knockout Kit (CRISPR)
KN223265LP 1 Kit

EP300 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: transverse
CS626054 5x 5 µm

Frozen Tissue Sections, Colon: transverse

Sign In for Pricing
View Details