Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNPTAB Peptide - N-terminal region

GNPTAB Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp762B226, GNPTA, ICD, KIAA1208, MGC4170

UniProt

Q3T906

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GNPTAB Rabbit Polyclonal Antibody (orb580879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077288

Preservative

Lyophilized powder

AA Sequence

FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLASH (CASP8AP2) Rabbit Polyclonal Antibody
TA374291 100 µL

FLASH (CASP8AP2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker), Biotin conjugate, 0.1mg/mL
BNCB1685-500 1x 500 µL

Calponin-1 (Smooth Muscle Marker), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCCA Mouse Monoclonal Antibody [Clone ID: OTI1E9]
CF811046 100 µg

PCCA Mouse Monoclonal Antibody [Clone ID: OTI1E9]

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-275-01 50 μL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-275-02 100 µL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-275-03 1 mL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details