Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gns Peptide - C-terminal region

Gns Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gns

UniProt

Q5M918

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gns Rabbit Polyclonal Antibody (orb579412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011989

Preservative

Lyophilized powder

AA Sequence

YIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROBO1 (994-1006) Goat Polyclonal Antibody
AP22501PU-N 50 µg

ROBO1 (994-1006) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Epsin 2 (EPN2) (NM_001102664) Human Over-expression Lysate
LY420185 100 µg

Epsin 2 (EPN2) (NM_001102664) Human Over-expression Lysate

Sign In for Pricing
View Details
RNASE13 (NM_001012264) Human Over-expression Lysate
LY423312 100 µg

RNASE13 (NM_001012264) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-KAP1 (S824) Recombinant Rabbit Monoclonal Antibody [JE50-99]
ET7110-11 100 µL

Phospho-KAP1 (S824) Recombinant Rabbit Monoclonal Antibody [JE50-99]

Sign In for Pricing
View Details
MAD1 (Ab-428) Antibody
8B1091-AAT 50 µg

MAD1 (Ab-428) Antibody

Sign In for Pricing
View Details
Ceacam1 Mouse Gene Knockout Kit (CRISPR)
KN503085 1 Kit

Ceacam1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details