Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLPH3 Peptide - middle region

GOLPH3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ90675, GOPP1, GPP34, MIDAS

UniProt

Q9H4A6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GOLPH3 Rabbit Polyclonal Antibody (orb585247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071413

Preservative

Lyophilized powder

AA Sequence

SLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thallium Ethoxide
TRC-T338870-5G 5 g

Thallium Ethoxide

Sign In for Pricing
View Details
3'-Azido-3'-deoxythymidine beta-D-glucuronide, Sodium Salt
TRC-A825050-25MG 25 mg

3'-Azido-3'-deoxythymidine beta-D-glucuronide, Sodium Salt

Sign In for Pricing
View Details
GLT25D2 (COLGALT2) (NM_001303421) Human Over-expression Lysate
LY438611 100 µg

GLT25D2 (COLGALT2) (NM_001303421) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Cluster Of Differentiation 19 (CD19) ELISA Kit
RDR-CD19-Ra-01 96 Tests

Rat Cluster Of Differentiation 19 (CD19) ELISA Kit

Sign In for Pricing
View Details
Rat Cluster Of Differentiation 19 (CD19) ELISA Kit
RDR-CD19-Ra-02 48 Tests

Rat Cluster Of Differentiation 19 (CD19) ELISA Kit

Sign In for Pricing
View Details
SOX2 (Embryonic Stem Cell Marker) (SOX2/3169R), CF640R conjugate, 0.1mg/mL
BNC403169-100 1x 100 µL

SOX2 (Embryonic Stem Cell Marker) (SOX2/3169R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details