Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLPH3 Peptide - middle region

GOLPH3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ90675, GOPP1, GPP34, MIDAS

UniProt

Q9H4A6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GOLPH3 Rabbit Polyclonal Antibody (orb585247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071413

Preservative

Lyophilized powder

AA Sequence

SLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HCK Antibody
RC-5734-01 50 μL

Recombinant HCK Antibody

Sign In for Pricing
View Details
Recombinant HCK Antibody
RC-5734-02 100 µL

Recombinant HCK Antibody

Sign In for Pricing
View Details
Recombinant HCK Antibody
RC-5734-03 1 mL

Recombinant HCK Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (P521S) (His Tag)
PKSV030425 100 µg

Recombinant SARS-CoV-2 Spike RBD (P521S) (His Tag)

Sign In for Pricing
View Details
Mouse PD-L1 Recombinant Rabbit Monoclonal Antibody [PSH05-04]
HA722209 100 µL

Mouse PD-L1 Recombinant Rabbit Monoclonal Antibody [PSH05-04]

Sign In for Pricing
View Details
Angiopoietin 2 Polyclonal Antibody
E-AB-60103-01 60 μL

Angiopoietin 2 Polyclonal Antibody

Sign In for Pricing
View Details