Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GORAB Peptide - C-terminal region

GORAB Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ11752, GO, MGC51263, MGC70512, NTKLBP1, SCYL1BP1

UniProt

Q5T7V8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GORAB Rabbit Polyclonal Antibody (orb585403) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689494

Preservative

Lyophilized powder

AA Sequence

ERLLHEQEVESRRPVVRLERPFQPAEESVTLEFAKENRKCQEQAVSPKVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse Atxn7 Antibody, HRP Conjugate
DZ41648-HRP 200 µL/Vial

Anti-Mouse Atxn7 Antibody, HRP Conjugate

Sign In for Pricing
View Details
AuH, 68-339aa, Human, His tag, E Coli
MBS203913-01 0.02 mg

AuH, 68-339aa, Human, His tag, E Coli

Sign In for Pricing
View Details
AuH, 68-339aa, Human, His tag, E Coli
MBS203913-02 0.1 mg

AuH, 68-339aa, Human, His tag, E Coli

Sign In for Pricing
View Details
AuH, 68-339aa, Human, His tag, E Coli
MBS203913-03 5x 0.02 mg

AuH, 68-339aa, Human, His tag, E Coli

Sign In for Pricing
View Details
AuH, 68-339aa, Human, His tag, E Coli
MBS203913-04 0.5 mg

AuH, 68-339aa, Human, His tag, E Coli

Sign In for Pricing
View Details
AuH, 68-339aa, Human, His tag, E Coli
MBS203913-05 5x 0.1 mg

AuH, 68-339aa, Human, His tag, E Coli

Sign In for Pricing
View Details