Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GORASP1 Peptide - N-terminal region

GORASP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ23443, GOLPH5, GRASP65, MGC118894, MGC118897, P65

UniProt

Q9BQQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GORASP1 Rabbit Polyclonal Antibody (orb583664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114105

Preservative

Lyophilized powder

AA Sequence

MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti human prorenin antiserum
MBS135352-01 1 mL

Rabbit anti human prorenin antiserum

Sign In for Pricing
View Details
Rabbit anti human prorenin antiserum
MBS135352-02 10 mL

Rabbit anti human prorenin antiserum

Sign In for Pricing
View Details
Rabbit anti human prorenin antiserum
MBS135352-03 5x 10 mL

Rabbit anti human prorenin antiserum

Sign In for Pricing
View Details
Human SSX2 (Protein SSX2) ELISA Kit
ELK0758-01 48 Tests

Human SSX2 (Protein SSX2) ELISA Kit

Sign In for Pricing
View Details
Human SSX2 (Protein SSX2) ELISA Kit
ELK0758-02 96 Tests

Human SSX2 (Protein SSX2) ELISA Kit

Sign In for Pricing
View Details
Human SSX2 (Protein SSX2) ELISA Kit
ELK0758-03 5x 96 Tests

Human SSX2 (Protein SSX2) ELISA Kit

Sign In for Pricing
View Details