Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GORASP1 Peptide - N-terminal region

GORASP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ23443, GOLPH5, GRASP65, MGC118894, MGC118897, P65

UniProt

Q9BQQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GORASP1 Rabbit Polyclonal Antibody (orb583664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114105

Preservative

Lyophilized powder

AA Sequence

MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA332355 100 µL

Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1700008O03Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
10131154 3x 1.0 µg DNA

1700008O03Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal Dengue Virus 2 Envelope Antibody [Janelia Fluor 646] - (Domain III) (New Guinea C/PUO-218 hybrid)
NBP3-33164JF646 0.1 mL

Rabbit Polyclonal Dengue Virus 2 Envelope Antibody [Janelia Fluor 646] - (Domain III) (New Guinea C/PUO-218 hybrid)

Sign In for Pricing
View Details
Recombinant Human PDGFD Protein (His-tag)
GB300044-H-500μg 500 μg

Recombinant Human PDGFD Protein (His-tag)

Sign In for Pricing
View Details
VPREB3 sgRNA CRISPR Lentivector (Human) (Target 2)
K2617003 1.0 µg DNA

VPREB3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
NUMB Protein Vector (Human) (pPB-C-His)
PV029193 500 ng

NUMB Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details