Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOSR1 Peptide - C-terminal region

GOSR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GOLIM2, GOS-28, GOS28, GOS28/P28, GS28, P28

UniProt

O95249

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GOSR1 Rabbit Polyclonal Antibody (orb326297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004862

Preservative

Lyophilized powder

AA Sequence

IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r6 Mouse Gene Knockout Kit (CRISPR)
KN519190 1 Kit

Vmn2r6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TCTP (TPT1) Rabbit Polyclonal Antibody
AP06666PU-N 100 µg

TCTP (TPT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Creatine
TRC-C781483-500MG 500 mg

Creatine

Sign In for Pricing
View Details
SMC2 Mouse Monoclonal Antibody [Clone ID: E1M]
AM05324PU-N 100 µg

SMC2 Mouse Monoclonal Antibody [Clone ID: E1M]

Sign In for Pricing
View Details
Human SLC13A4 activation kit by CRISPRa
GA108829 1 Kit

Human SLC13A4 activation kit by CRISPRa

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), CF568 conjugate, 0.1mg/mL
BNC681773-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details