Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOSR1 Peptide - C-terminal region

GOSR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GOLIM2, GOS-28, GOS28, GOS28/P28, GS28, P28

UniProt

O95249

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GOSR1 Rabbit Polyclonal Antibody (orb326297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004862

Preservative

Lyophilized powder

AA Sequence

IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-2’-hydroxyacetophenone
TRC-B684455-500MG 500 mg

2-Bromo-2’-hydroxyacetophenone

Sign In for Pricing
View Details
Rpa2 Mouse Gene Knockout Kit (CRISPR)
KN514995 1 Kit

Rpa2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PDP2 activation kit by CRISPRa
GA111578 1 Kit

Human PDP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human NFATC2IP activation kit by CRISPRa
GA113753 1 Kit

Human NFATC2IP activation kit by CRISPRa

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF647 conjugate, 0.1mg/mL
BNC472332-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), Biotin conjugate, 0.1mg/mL
BNCB1828-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details