Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOSR2 Peptide - N-terminal region

GOSR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Bos1, GS27, EPM6

UniProt

O14653

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GOSR2 Rabbit Polyclonal Antibody (orb326408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004278

Preservative

Lyophilized powder

AA Sequence

ASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTG2 (NM_001615) Human Over-expression Lysate
LC419843 20 µg

ACTG2 (NM_001615) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Elongation factor 1 gamma Antibody
RC-15032-01 50 μL

Recombinant Elongation factor 1 gamma Antibody

Sign In for Pricing
View Details
Recombinant Elongation factor 1 gamma Antibody
RC-15032-02 100 µL

Recombinant Elongation factor 1 gamma Antibody

Sign In for Pricing
View Details
Recombinant Elongation factor 1 gamma Antibody
RC-15032-03 1 mL

Recombinant Elongation factor 1 gamma Antibody

Sign In for Pricing
View Details
NEMP1 antibody
FNab08766 100 µg

NEMP1 antibody

Sign In for Pricing
View Details
Triphenylphosphine Oxide-d15
TRC-T808982-50MG 50 mg

Triphenylphosphine Oxide-d15

Sign In for Pricing
View Details