Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOSR2 Peptide - N-terminal region

GOSR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Bos1, GS27, EPM6

UniProt

O14653

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GOSR2 Rabbit Polyclonal Antibody (orb326408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004278

Preservative

Lyophilized powder

AA Sequence

ASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF640R conjugate, 0.1mg/mL
BNC401976-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LTF Polyclonal Antibody
E-AB-65979-01 60 µL

LTF Polyclonal Antibody

Sign In for Pricing
View Details
LTF Polyclonal Antibody
E-AB-65979-02 120 µL

LTF Polyclonal Antibody

Sign In for Pricing
View Details
LTF Polyclonal Antibody
E-AB-65979-03 200 µL

LTF Polyclonal Antibody

Sign In for Pricing
View Details
TERF1 Polyclonal Antibody
E-AB-18252-01 20 µL

TERF1 Polyclonal Antibody

Sign In for Pricing
View Details
TERF1 Polyclonal Antibody
E-AB-18252-02 60 µL

TERF1 Polyclonal Antibody

Sign In for Pricing
View Details