Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GP5 Peptide - C-terminal region

GP5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD42d

UniProt

P40197

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GP5 Rabbit Polyclonal Antibody (orb326464) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004479

Preservative

Lyophilized powder

AA Sequence

PNSSEPWVWAQPVTTGKGQDHSPFWGFYFLLLAVQAMITVIIVFAMIKIG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Clathrin heavy chain 1 (CLTC) ELISA Kit
GTR10312602 96 Well

Human Clathrin heavy chain 1 (CLTC) ELISA Kit

Sign In for Pricing
View Details
Bz 423
T14846-01 1 mg

Bz 423

Sign In for Pricing
View Details
Bz 423
T14846-02 5 mg

Bz 423

Sign In for Pricing
View Details
Bz 423
T14846-03 1 mL - 10 mM (in DMSO)

Bz 423

Sign In for Pricing
View Details
Ptcd3 Mouse Pre-designed siRNA Set A
HY-RS21703 1 Set

Ptcd3 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Monoclonal TC-PTP/PTPN2 Antibody (001) [DyLight 550]
NBP2-90722R 0.1 mL

Rabbit Monoclonal TC-PTP/PTPN2 Antibody (001) [DyLight 550]

Sign In for Pricing
View Details