Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GP5 Peptide - C-terminal region

GP5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD42d

UniProt

P40197

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GP5 Rabbit Polyclonal Antibody (orb326464) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004479

Preservative

Lyophilized powder

AA Sequence

PNSSEPWVWAQPVTTGKGQDHSPFWGFYFLLLAVQAMITVIIVFAMIKIG

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAF250b Polyclonal Antibody
MBS9242808-01 0.1 mL

BAF250b Polyclonal Antibody

Sign In for Pricing
View Details
BAF250b Polyclonal Antibody
MBS9242808-02 5x 0.1 mL

BAF250b Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TCF4 antibody
PAab08553 100 µg

Anti-TCF4 antibody

Sign In for Pricing
View Details
ATF6 Rabbit Polyclonal Antibody (FITC)
orb2142593 100 µL

ATF6 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
NR3A Double Nickase Plasmid (m)
sc-433899-NIC 20 µg

NR3A Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Akt discontinued
385632 200 µL

Akt discontinued

Sign In for Pricing
View Details