Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GP9 Peptide - middle region

GP9 Peptide - middle region

Product Specifications

Product Name Alternative

CD42a, GPIX

UniProt

P14770

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GP9 Rabbit Polyclonal Antibody (orb585049) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000165

Preservative

Lyophilized powder

AA Sequence

NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1153 Double Nickase Plasmid (m)
sc-434761-NIC 20 µg

Olfr1153 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Lentiviral human UBE2S shRNA (UAS) - Lentiviral human UBE2S shRNA (UAS, iRFP) (25)
GTR15111854 1 Vial

Lentiviral human UBE2S shRNA (UAS) - Lentiviral human UBE2S shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
PI3 Kinase P85α (3B7) Mouse mAb
E2250209 100 µL

PI3 Kinase P85α (3B7) Mouse mAb

Sign In for Pricing
View Details
(R) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3-aminopropanoic acid
OR1034988-01 100 mg

(R) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3-aminopropanoic acid

Sign In for Pricing
View Details
(R) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3-aminopropanoic acid
OR1034988-02 250 mg

(R) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3-aminopropanoic acid

Sign In for Pricing
View Details
(R) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3-aminopropanoic acid
OR1034988-03 1 g

(R) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3-aminopropanoic acid

Sign In for Pricing
View Details