Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GP9 Peptide - middle region

GP9 Peptide - middle region

Product Specifications

Product Name Alternative

CD42a, GPIX

UniProt

P14770

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GP9 Rabbit Polyclonal Antibody (orb585049) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000165

Preservative

Lyophilized powder

AA Sequence

NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHDC8A Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-8358R-BF405 100 µL

KLHDC8A Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
DDIT3 Antibody
MBS2518046-01 0.06 mL

DDIT3 Antibody

Sign In for Pricing
View Details
DDIT3 Antibody
MBS2518046-02 0.12 mL

DDIT3 Antibody

Sign In for Pricing
View Details
DDIT3 Antibody
MBS2518046-03 0.2 mL

DDIT3 Antibody

Sign In for Pricing
View Details
E2F5 siRNA (Mouse)
orb1848174-01 15 nmol

E2F5 siRNA (Mouse)

Sign In for Pricing
View Details
E2F5 siRNA (Mouse)
orb1848174-02 30 nmol

E2F5 siRNA (Mouse)

Sign In for Pricing
View Details