Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR174 Peptide - C-terminal region

GPR174 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FKSG79

UniProt

Q9BXC1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR174 Rabbit Polyclonal Antibody (orb584623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115942

Preservative

Lyophilized powder

AA Sequence

DKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), CF405S conjugate, 0.1mg/mL
BNC042477-500 1x 500 µL

MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Licarin B
OR1024120-01 25 mg

Licarin B

Sign In for Pricing
View Details
Licarin B
OR1024120-02 50 mg

Licarin B

Sign In for Pricing
View Details
Licarin B
OR1024120-03 100 mg

Licarin B

Sign In for Pricing
View Details
Licarin B
OR1024120-04 250 mg

Licarin B

Sign In for Pricing
View Details
NSUN2 Protein Vector (Human) (pPM-C-His)
PV028944 500 ng

NSUN2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details