Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR174 Peptide - C-terminal region

GPR174 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FKSG79

UniProt

Q9BXC1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR174 Rabbit Polyclonal Antibody (orb584623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115942

Preservative

Lyophilized powder

AA Sequence

DKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal GluR1 [p Ser845] Antibody (296)
NBP2-61472 100 µL

Rabbit Monoclonal GluR1 [p Ser845] Antibody (296)

Sign In for Pricing
View Details
ELISA Kit For Eukaryotic translation initiation factor 4E
E15567b 96 Tests

ELISA Kit For Eukaryotic translation initiation factor 4E

Sign In for Pricing
View Details
Canine Thyroglobulin  (TGB) ELISA Kit
MBS2608140-01 48 Well

Canine Thyroglobulin  (TGB) ELISA Kit

Sign In for Pricing
View Details
Canine Thyroglobulin  (TGB) ELISA Kit
MBS2608140-02 96 Well

Canine Thyroglobulin  (TGB) ELISA Kit

Sign In for Pricing
View Details
Canine Thyroglobulin  (TGB) ELISA Kit
MBS2608140-03 5x 96 Well

Canine Thyroglobulin  (TGB) ELISA Kit

Sign In for Pricing
View Details
Canine Thyroglobulin  (TGB) ELISA Kit
MBS2608140-04 10x 96 Well

Canine Thyroglobulin  (TGB) ELISA Kit

Sign In for Pricing
View Details