Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR19 Peptide - C-terminal region

GPR19 Peptide - C-terminal region

Product Specifications

UniProt

Q15760

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR19 Rabbit Polyclonal Antibody (orb585483) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006134

Preservative

Lyophilized powder

AA Sequence

LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAIM3 (FCMR) (NM_005449) Human Over-expression Lysate
LC401671 20 µg

FAIM3 (FCMR) (NM_005449) Human Over-expression Lysate

Sign In for Pricing
View Details
AMBP Antibody
KC-383-01 50 μL

AMBP Antibody

Sign In for Pricing
View Details
AMBP Antibody
KC-383-02 100 µL

AMBP Antibody

Sign In for Pricing
View Details
AMBP Antibody
KC-383-03 1 mL

AMBP Antibody

Sign In for Pricing
View Details
N1-(2-(Tritylthio)ethyl)propane-1,3-diamine
TRC-T890050-500MG 500 mg

N1-(2-(Tritylthio)ethyl)propane-1,3-diamine

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2065), CF740 conjugate, 0.1mg/mL
BNC742065-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2065), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details