Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR19 Peptide - C-terminal region

GPR19 Peptide - C-terminal region

Product Specifications

UniProt

Q15760

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR19 Rabbit Polyclonal Antibody (orb585483) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006134

Preservative

Lyophilized powder

AA Sequence

LNLLFLLSWLPFHVAQLWHPHEQDYKKSSLVFTAITWISFSSSASKPTLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary
CS800053 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Neomycin Trisulfate Hydrate
TRC-N389975-100G 100 g

Neomycin Trisulfate Hydrate

Sign In for Pricing
View Details
SLC9A3R1 Rabbit Monoclonal Antibody [Clone ID: 24GB1270]
TA425009 100 µL

SLC9A3R1 Rabbit Monoclonal Antibody [Clone ID: 24GB1270]

Sign In for Pricing
View Details
PLAC8L1 Mouse Monoclonal Antibody [Clone ID: OTI8H8]
CF811566 100 µg

PLAC8L1 Mouse Monoclonal Antibody [Clone ID: OTI8H8]

Sign In for Pricing
View Details
EIF4A2 (C-term) Rabbit Polyclonal Antibody
AP51399PU-N 400 µL

EIF4A2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Phenylephrine
TRC-P320688-250MG 250 mg

L-Phenylephrine

Sign In for Pricing
View Details