Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR27 Peptide - middle region

GPR27 Peptide - middle region

Product Specifications

Product Name Alternative

SREB1

UniProt

Q9NS67

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR27 Rabbit Polyclonal Antibody (orb580233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061844

Preservative

Lyophilized powder

AA Sequence

LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Bromopyridine-2-carbonitrile
TRC-B686753-250MG 250 mg

4-Bromopyridine-2-carbonitrile

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS505049 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
(R)-Rexamino Hydrochloride
TRC-R425630-50MG 50 mg

(R)-Rexamino Hydrochloride

Sign In for Pricing
View Details
Recombinant Mouse SIRPA/CD172a Protein (MIgG2a Tag)
PKSM041146-01 10 µg

Recombinant Mouse SIRPA/CD172a Protein (MIgG2a Tag)

Sign In for Pricing
View Details
Recombinant Mouse SIRPA/CD172a Protein (MIgG2a Tag)
PKSM041146-02 50 µg

Recombinant Mouse SIRPA/CD172a Protein (MIgG2a Tag)

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF647 conjugate, 0.1mg/mL
BNC470940-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details