Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR27 Peptide - middle region

GPR27 Peptide - middle region

Product Specifications

Product Name Alternative

SREB1

UniProt

Q9NS67

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR27 Rabbit Polyclonal Antibody (orb580233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061844

Preservative

Lyophilized powder

AA Sequence

LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp27 Antibody (Biotin)
KB-1096-01 50 μL

Hsp27 Antibody (Biotin)

Sign In for Pricing
View Details
Hsp27 Antibody (Biotin)
KB-1096-02 100 µL

Hsp27 Antibody (Biotin)

Sign In for Pricing
View Details
Hsp27 Antibody (Biotin)
KB-1096-03 1 mL

Hsp27 Antibody (Biotin)

Sign In for Pricing
View Details
SLC44A4 Human Gene Knockout Kit (CRISPR)
KN417264 1 Kit

SLC44A4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tapasin Related Protein (TAPBPL) Human Gene Knockout Kit (CRISPR)
KN401899 1 Kit

Tapasin Related Protein (TAPBPL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Bromopentane-2,4-dione
TRC-B804185-1G 1 g

3-Bromopentane-2,4-dione

Sign In for Pricing
View Details