Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR37L1 Peptide - C-terminal region

GPR37L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ET (B) R-LP-2, ETBR-LP-2

UniProt

O60883

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR37L1 Rabbit Polyclonal Antibody (orb585366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004758

Preservative

Lyophilized powder

AA Sequence

CYFCLPILFTVTCQLVTWRVRGPPGRKSECRASKHEQCESQLNSTVVGLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBEF / NAMPT Polyclonal Antibody
E-AB-60047-01 60 µL

PBEF / NAMPT Polyclonal Antibody

Sign In for Pricing
View Details
PBEF / NAMPT Polyclonal Antibody
E-AB-60047-02 120 µL

PBEF / NAMPT Polyclonal Antibody

Sign In for Pricing
View Details
PBEF / NAMPT Polyclonal Antibody
E-AB-60047-03 200 µL

PBEF / NAMPT Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Cartilage
CR562299 5 µg

Tissue Total RNA, Cartilage

Sign In for Pricing
View Details
FNTB Antibody
8C17991-AAT 50 µg

FNTB Antibody

Sign In for Pricing
View Details
RAC1 (NM_018890) Human Recombinant Protein
TP324262 20 µg

RAC1 (NM_018890) Human Recombinant Protein

Sign In for Pricing
View Details