Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR37L1 Peptide - C-terminal region

GPR37L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ET (B) R-LP-2, ETBR-LP-2

UniProt

O60883

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR37L1 Rabbit Polyclonal Antibody (orb585366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004758

Preservative

Lyophilized powder

AA Sequence

CYFCLPILFTVTCQLVTWRVRGPPGRKSECRASKHEQCESQLNSTVVGLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC3R Rabbit Polyclonal Antibody
TA361222 100 µL

MC3R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR560932 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
Ceturegel™ Matrix hESC-Qualified,LDEV-Free
40190ES08 5 mL

Ceturegel™ Matrix hESC-Qualified,LDEV-Free

Sign In for Pricing
View Details
Cd44 Rat Monoclonal Antibody [Clone ID: IM7.8.1]
CL024F 100 µg

Cd44 Rat Monoclonal Antibody [Clone ID: IM7.8.1]

Sign In for Pricing
View Details
Terephthaloyl Chloride
TRC-T112505-50G 50 g

Terephthaloyl Chloride

Sign In for Pricing
View Details
Human Keratin 80 (KRT80) activation kit by CRISPRa
GA115500 1 Kit

Human Keratin 80 (KRT80) activation kit by CRISPRa

Sign In for Pricing
View Details