Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR52 Peptide - C-terminal region

GPR52 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC111751

UniProt

Q9Y2T5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR52 Rabbit Polyclonal Antibody (orb585433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005675

Preservative

Lyophilized powder

AA Sequence

SNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDQEAQEPKPRKRAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1RN Antibody - HRP Conjugated
OACA01400-100UG 100 µg

IL1RN Antibody - HRP Conjugated

Sign In for Pricing
View Details
Human PNMA1 (NM_006029) AAV Particle
RC208021A1V 250 µL

Human PNMA1 (NM_006029) AAV Particle

Sign In for Pricing
View Details
Rat Mediator of RNA polymerase II transcription subunit 27 (MED27) ELISA Kit
GTR10345613 96 Well

Rat Mediator of RNA polymerase II transcription subunit 27 (MED27) ELISA Kit

Sign In for Pricing
View Details
Sdr16c5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4132306 1.0 µg DNA

Sdr16c5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
GRF (1-29) amide, rat
E-PP-1251-01 1 mg

GRF (1-29) amide, rat

Sign In for Pricing
View Details
GRF (1-29) amide, rat
E-PP-1251-02 10 mg

GRF (1-29) amide, rat

Sign In for Pricing
View Details