Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR52 Peptide - C-terminal region

GPR52 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC111751

UniProt

Q9Y2T5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR52 Rabbit Polyclonal Antibody (orb585433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005675

Preservative

Lyophilized powder

AA Sequence

SNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDQEAQEPKPRKRAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fgf13 Antibody Middle region
ARP90557_P050 100 µL

Fgf13 Antibody Middle region

Sign In for Pricing
View Details
OR4C15 Antibody, FITC conjugated
A77056-100UL 100 µL

OR4C15 Antibody, FITC conjugated

Sign In for Pricing
View Details
CCBL1, 1-422aa, Human, His tag, E.coli
E53A01442 50 µg

CCBL1, 1-422aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Hemoglobin (HB) Rabbit ELISA Kit
D9341 96 Tests

Hemoglobin (HB) Rabbit ELISA Kit

Sign In for Pricing
View Details
Placental Lactogen, Recombinant, Human, aa27-217, His-Tag
552174-01 50 µg

Placental Lactogen, Recombinant, Human, aa27-217, His-Tag

Sign In for Pricing
View Details
Placental Lactogen, Recombinant, Human, aa27-217, His-Tag
552174-02 100 µg

Placental Lactogen, Recombinant, Human, aa27-217, His-Tag

Sign In for Pricing
View Details