Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR75 Peptide - C-terminal region

GPR75 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPRchr2, MGC132002, WI31133

UniProt

O95800

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR75 Rabbit Polyclonal Antibody (orb574928) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006785

Preservative

Lyophilized powder

AA Sequence

ALYRNQNYNKLQHVQTRGYTKSPNQLVTPAASRLQLVSAINLSTAKDSKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human General Transcription Factor IIA, Polypeptide 1 (GTF2A1) ELISA Kit
201-12-2709 96 Tests

Human General Transcription Factor IIA, Polypeptide 1 (GTF2A1) ELISA Kit

Sign In for Pricing
View Details
Glucokinase (GCK) Rabbit pAb
E45R28841N-50 50 µL

Glucokinase (GCK) Rabbit pAb

Sign In for Pricing
View Details
Anti-LAG3 (alcestobart biosimilar) mAb
12-90050-50 50 µg

Anti-LAG3 (alcestobart biosimilar) mAb

Sign In for Pricing
View Details
CD44 (NM_001001392) Human Tagged ORF Clone Lentiviral Particle
RC212723L3V 200 µL

CD44 (NM_001001392) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Methylisopelletierine
CS-BT-00447 1 Each

Methylisopelletierine

Sign In for Pricing
View Details
Rabbit Proline ELISA kit
GTR10432680 96 Well

Rabbit Proline ELISA kit

Sign In for Pricing
View Details