Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR75 Peptide - C-terminal region

GPR75 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPRchr2, MGC132002, WI31133

UniProt

O95800

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR75 Rabbit Polyclonal Antibody (orb574928) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006785

Preservative

Lyophilized powder

AA Sequence

ALYRNQNYNKLQHVQTRGYTKSPNQLVTPAASRLQLVSAINLSTAKDSKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Rat anti-Mouse IgM Heavy Chain Secondary Antibody (eB121-15F9) [PerCP]
NBP1-43282PCP 0.5 mL

Rat Monoclonal Rat anti-Mouse IgM Heavy Chain Secondary Antibody (eB121-15F9) [PerCP]

Sign In for Pricing
View Details
RPS1B Antibody
orb849615 2 mg

RPS1B Antibody

Sign In for Pricing
View Details
Mouse IgG (H&L) Antibody - AP Conjugated
OARA04612-1MG 1 mg

Mouse IgG (H&L) Antibody - AP Conjugated

Sign In for Pricing
View Details
SLITRK6 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11960R-BF594 100 µL

SLITRK6 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
HCAP G Polyclonal Antibody, PerCP Conjugated
bs-15422R-PerCP 100 µL

HCAP G Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
ANP32E Antibody
A46863-100UL 100 µL

ANP32E Antibody

Sign In for Pricing
View Details