Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR87 Peptide - N-terminal region

GPR87 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FKSG78, GPR95, KPG_002, MGC131898

UniProt

Q9BY21

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR87 Rabbit Polyclonal Antibody (orb578542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076404

Preservative

Lyophilized powder

AA Sequence

MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp4a Mouse shRNA Plasmid (Locus ID 11944)
TR500162 1 Kit

Atp4a Mouse shRNA Plasmid (Locus ID 11944)

Sign In for Pricing
View Details
Rabbit Anti Human TLR3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul
IRBAHUTLR3AP875120UL 120 µL

Rabbit Anti Human TLR3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul

Sign In for Pricing
View Details
TCF7L2 Recombinant Antibody, Biotin Conjugated
bsm-52543R-Biotin 100 µL

TCF7L2 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal SCF/c-kit Ligand Antibody (004) [Alexa Fluor 405]
NBP2-89504AF405 0.1 mL

Rabbit Monoclonal SCF/c-kit Ligand Antibody (004) [Alexa Fluor 405]

Sign In for Pricing
View Details
TOM1 (Target of Myb Protein 1) (MaxLight 750)
MBS6235830-01 0.1 mL

TOM1 (Target of Myb Protein 1) (MaxLight 750)

Sign In for Pricing
View Details
TOM1 (Target of Myb Protein 1) (MaxLight 750)
MBS6235830-02 5x 0.1 mL

TOM1 (Target of Myb Protein 1) (MaxLight 750)

Sign In for Pricing
View Details