Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR87 Peptide - N-terminal region

GPR87 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FKSG78, GPR95, KPG_002, MGC131898

UniProt

Q9BY21

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR87 Rabbit Polyclonal Antibody (orb578542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076404

Preservative

Lyophilized powder

AA Sequence

MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O157:H7 YKFJ Polyclonal Antibody
MBS9004845 Inquire

Rabbit anti-Escherichia coli O157:H7 YKFJ Polyclonal Antibody

Sign In for Pricing
View Details
GABRE Antibody
GWB-6494D6 0.05 mg

GABRE Antibody

Sign In for Pricing
View Details
Mouse Monoclonal ITM2B Antibody (OTI1C11) [DyLight 650]
NBP2-71460C 0.1 mL

Mouse Monoclonal ITM2B Antibody (OTI1C11) [DyLight 650]

Sign In for Pricing
View Details
Human Regulator Of G Protein Signaling 7 (RGS7) ELISA Kit
MBS2705208-01 24 Strip Well

Human Regulator Of G Protein Signaling 7 (RGS7) ELISA Kit

Sign In for Pricing
View Details
Human Regulator Of G Protein Signaling 7 (RGS7) ELISA Kit
MBS2705208-02 48 Well

Human Regulator Of G Protein Signaling 7 (RGS7) ELISA Kit

Sign In for Pricing
View Details
Human Regulator Of G Protein Signaling 7 (RGS7) ELISA Kit
MBS2705208-03 96 Well

Human Regulator Of G Protein Signaling 7 (RGS7) ELISA Kit

Sign In for Pricing
View Details