Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gpr88 Peptide - C-terminal region

Gpr88 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gpr88

UniProt

Q9ESP4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gpr88 Rabbit Polyclonal Antibody (orb578540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113884

Preservative

Lyophilized powder

AA Sequence

LYTWRNEEFRRSVRSVLPGVGDAAAAAAAATAVPAMSQAQLGTRAAGQHW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108UM-01 25 µg

Elab Fluor® 647 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108UM-02 100 µg

Elab Fluor® 647 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
RAB7B (NM_001164522) Human Recombinant Protein
TP328755L 1 mg

RAB7B (NM_001164522) Human Recombinant Protein

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF594 conjugate, 0.1mg/mL
BNC941136-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (NM_001777) Human Over-expression Lysate
LY419754 100 µg

CD47 (NM_001777) Human Over-expression Lysate

Sign In for Pricing
View Details
CCR2 Human Gene Knockout Kit (CRISPR)
KN421234 1 Kit

CCR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details