Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gpr88 Peptide - C-terminal region

Gpr88 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gpr88

UniProt

Q9ESP4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gpr88 Rabbit Polyclonal Antibody (orb578540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113884

Preservative

Lyophilized powder

AA Sequence

LYTWRNEEFRRSVRSVLPGVGDAAAAAAAATAVPAMSQAQLGTRAAGQHW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cynomolgus CD3e/CD3ε Protein (Fc Tag)
PKSQ050030-01 10 µg

Recombinant Cynomolgus CD3e/CD3ε Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Cynomolgus CD3e/CD3ε Protein (Fc Tag)
PKSQ050030-02 50 µg

Recombinant Cynomolgus CD3e/CD3ε Protein (Fc Tag)

Sign In for Pricing
View Details
RGS14 Rabbit Polyclonal Antibody
TA362032 100 µL

RGS14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLEC1A Polyclonal Antibody
E-AB-14004-01 20 µL

CLEC1A Polyclonal Antibody

Sign In for Pricing
View Details
CLEC1A Polyclonal Antibody
E-AB-14004-02 60 µL

CLEC1A Polyclonal Antibody

Sign In for Pricing
View Details
CLEC1A Polyclonal Antibody
E-AB-14004-03 120 µL

CLEC1A Polyclonal Antibody

Sign In for Pricing
View Details