Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPRC5B Peptide - N-terminal region

GPRC5B Peptide - N-terminal region

Product Specifications

Product Name Alternative

RAIG-2, RAIG2

UniProt

Q9NZH0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPRC5B Rabbit Polyclonal Antibody (orb584461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057319

Preservative

Lyophilized powder

AA Sequence

AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfuric Acid Solution 10% (v/v)
40220148-2 1 L

Sulfuric Acid Solution 10% (v/v)

Sign In for Pricing
View Details
Ndn Double Nickase Plasmid (h2)
sc-405902-NIC-2 20 µg

Ndn Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
ZNF346 Polyclonal Antibody, HRP Conjugated
bs-12235R-HRP 100 µL

ZNF346 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Two-component response regulator ARR10 (ARR10) , partial
MBS1132139 Inquire

Recombinant Arabidopsis thaliana Two-component response regulator ARR10 (ARR10) , partial

Sign In for Pricing
View Details
N-Myc Double Nickase Plasmid (h2)
sc-400253-NIC-2 20 µg

N-Myc Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
ZNF133 Antibody
OACA03953-100UG 100 µg

ZNF133 Antibody

Sign In for Pricing
View Details