Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPT2 Peptide - C-terminal region

GPT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALT2

UniProt

Q8TD30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_597700

Preservative

Lyophilized powder

AA Sequence

PEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFATC2IP ORF Vector (Human) (pORF)
31763012 1.0 µg DNA

NFATC2IP ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SLUG (h) : 293T Lysate
sc-111858 100 µg - 200 µL

SLUG (h) : 293T Lysate

Sign In for Pricing
View Details
B3GNT9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0164508 1.0 µg DNA

B3GNT9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lgals4 Antibody - C-terminal region
ARP42280_P050-25UL 25 µL

Lgals4 Antibody - C-terminal region

Sign In for Pricing
View Details
Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)
MBS2100879-01 5x 96 Tests

Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)
MBS2100879-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details