Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRAMD2B Peptide - middle region

GRAMD2B Peptide - middle region

Product Specifications

Product Name Alternative

GRAMD3, NS3TP2

UniProt

Q96HH9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRAMD2B Rabbit Polyclonal Antibody (orb330598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076416

Preservative

Lyophilized powder

AA Sequence

LSRDSTYKLLKSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BTG3 Associated Nuclear Protein (BANP) ELISA Kit
TRV-0002913 96 Well Plate

Human BTG3 Associated Nuclear Protein (BANP) ELISA Kit

Sign In for Pricing
View Details
CXCL2 protein (Mouse) (His tag)
80R-3349 0.1 mg

CXCL2 protein (Mouse) (His tag)

Sign In for Pricing
View Details
bectenecin Lentiviral Activation Particles (m2)
sc-421892-LAC-2 200 µL

bectenecin Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
SNX18 (F-10)
sc-515461 200 µg/mL

SNX18 (F-10)

Sign In for Pricing
View Details
Recombinant Jug n 4
A10R82 1 Each

Recombinant Jug n 4

Sign In for Pricing
View Details
Extl1 (NM_019578) Mouse Tagged ORF Clone Lentiviral Particle
MR223710L4V 200 µL

Extl1 (NM_019578) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details