Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRAMD2B Peptide - middle region

GRAMD2B Peptide - middle region

Product Specifications

Product Name Alternative

GRAMD3, NS3TP2

UniProt

Q96HH9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRAMD2B Rabbit Polyclonal Antibody (orb330598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076416

Preservative

Lyophilized powder

AA Sequence

LSRDSTYKLLKSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LY6E (NM_001127213) AAV Particle
RC225092A1V 250 µL

Human LY6E (NM_001127213) AAV Particle

Sign In for Pricing
View Details
Col4a5 Mouse shRNA Lentiviral Particle (Locus ID 12830)
TL500402V 500 µL Each

Col4a5 Mouse shRNA Lentiviral Particle (Locus ID 12830)

Sign In for Pricing
View Details
13 (S) -HODE-biotin
orb1692419 1 mg

13 (S) -HODE-biotin

Sign In for Pricing
View Details
100bp DNA ladder, 100-1500bp, 1 x 500ul vial
CSL-MDNA-100BP 1 Unit

100bp DNA ladder, 100-1500bp, 1 x 500ul vial

Sign In for Pricing
View Details
CCND3, Phosphorylated (S264) (CCND3, G1/S-specific cyclin-D3) (MaxLight 550)
MBS6282362-01 0.1 mL

CCND3, Phosphorylated (S264) (CCND3, G1/S-specific cyclin-D3) (MaxLight 550)

Sign In for Pricing
View Details
CCND3, Phosphorylated (S264) (CCND3, G1/S-specific cyclin-D3) (MaxLight 550)
MBS6282362-02 5x 0.1 mL

CCND3, Phosphorylated (S264) (CCND3, G1/S-specific cyclin-D3) (MaxLight 550)

Sign In for Pricing
View Details