Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRAP Peptide - middle region

GRAP Peptide - middle region

Product Specifications

Product Name Alternative

MGC64880

UniProt

Q13588

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRAP Rabbit Polyclonal Antibody (orb330672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006604

Preservative

Lyophilized powder

AA Sequence

KRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPD

More Discoveries

Explore Other Products

Browse additional items from our catalog

IARS2 (Isoleucyl-tRNA Synthetase 2 Mitochondrial, IleRS, FLJ10326, Isoleucine-tRNA Ligase) (MaxLight 490)
MBS6481355-01 0.1 mL

IARS2 (Isoleucyl-tRNA Synthetase 2 Mitochondrial, IleRS, FLJ10326, Isoleucine-tRNA Ligase) (MaxLight 490)

Sign In for Pricing
View Details
IARS2 (Isoleucyl-tRNA Synthetase 2 Mitochondrial, IleRS, FLJ10326, Isoleucine-tRNA Ligase) (MaxLight 490)
MBS6481355-02 5x 0.1 mL

IARS2 (Isoleucyl-tRNA Synthetase 2 Mitochondrial, IleRS, FLJ10326, Isoleucine-tRNA Ligase) (MaxLight 490)

Sign In for Pricing
View Details
RPL13A ELISA Kit (Human)
OKCD09456-96W 96 Well

RPL13A ELISA Kit (Human)

Sign In for Pricing
View Details
Histone H2B(Acetyl-Lys5) Rabbit Polyclonal Antibody
MBS9405532-01 0.1 mL

Histone H2B(Acetyl-Lys5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2B(Acetyl-Lys5) Rabbit Polyclonal Antibody
MBS9405532-02 5x 0.1 mL

Histone H2B(Acetyl-Lys5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
pCMV-BUB1-3×FLAG-Neo Plasmid
PVT62764 2 µg

pCMV-BUB1-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details