Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRAP Peptide - middle region

GRAP Peptide - middle region

Product Specifications

Product Name Alternative

MGC64880

UniProt

Q13588

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRAP Rabbit Polyclonal Antibody (orb330672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006604

Preservative

Lyophilized powder

AA Sequence

KRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPD

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRP19 Polyclonal Antibody
BT-AP07420-01 20 µL

PRP19 Polyclonal Antibody

Sign In for Pricing
View Details
PRP19 Polyclonal Antibody
BT-AP07420-02 50 µL

PRP19 Polyclonal Antibody

Sign In for Pricing
View Details
PRP19 Polyclonal Antibody
BT-AP07420-03 100 µL

PRP19 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human BCL6, Rabbit Polyclonal
KB4594GNP Inquire

Anti-Human BCL6, Rabbit Polyclonal

Sign In for Pricing
View Details
Human High Density Lipoprotein
MBS143110-01 10 mg

Human High Density Lipoprotein

Sign In for Pricing
View Details
Human High Density Lipoprotein
MBS143110-02 100 mg

Human High Density Lipoprotein

Sign In for Pricing
View Details