Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GREM2 Peptide - N-terminal region

GREM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CKTSF1B2, DAND3, PRDC

UniProt

Q9H772

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GREM2 Rabbit Polyclonal Antibody (orb583647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071914

Preservative

Lyophilized powder

AA Sequence

MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhizobium meliloti ATP synthase subunit b/b'(atpG), partial
MBS7096966 Inquire

Recombinant Rhizobium meliloti ATP synthase subunit b/b'(atpG), partial

Sign In for Pricing
View Details
N- (3-Aminopropyl) morpholine 98%
A28140-01 50 g

N- (3-Aminopropyl) morpholine 98%

Sign In for Pricing
View Details
N- (3-Aminopropyl) morpholine 98%
A28140-02 250 g

N- (3-Aminopropyl) morpholine 98%

Sign In for Pricing
View Details
N- (3-Aminopropyl) morpholine 98%
A28140-03 1000 g

N- (3-Aminopropyl) morpholine 98%

Sign In for Pricing
View Details
Limd1 Polyclonal Antibody, HRP Conjugated
bs-7336R-HRP 100 µL

Limd1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
CDKN2AIP Rabbit pAb
E2821080 100 µL

CDKN2AIP Rabbit pAb

Sign In for Pricing
View Details