Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GREM2 Peptide - N-terminal region

GREM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CKTSF1B2, DAND3, PRDC

UniProt

Q9H772

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GREM2 Rabbit Polyclonal Antibody (orb583647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071914

Preservative

Lyophilized powder

AA Sequence

MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-C10orf137
YF-PA18210 50 ug

anti-C10orf137

Sign In for Pricing
View Details
Human VTCN1 ELISA Kit (Ready to Use)
orb552773-01 48 Tests

Human VTCN1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human VTCN1 ELISA Kit (Ready to Use)
orb552773-02 96 Tests

Human VTCN1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human Ribonucleases P/MRP protein subunit POP1, POP1 ELISA Kit
MBS9326475-01 48 Well

Human Ribonucleases P/MRP protein subunit POP1, POP1 ELISA Kit

Sign In for Pricing
View Details
Human Ribonucleases P/MRP protein subunit POP1, POP1 ELISA Kit
MBS9326475-02 96 Well

Human Ribonucleases P/MRP protein subunit POP1, POP1 ELISA Kit

Sign In for Pricing
View Details
Human Ribonucleases P/MRP protein subunit POP1, POP1 ELISA Kit
MBS9326475-03 5x 96 Well

Human Ribonucleases P/MRP protein subunit POP1, POP1 ELISA Kit

Sign In for Pricing
View Details